PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00045.1_g00065.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 341aa    MW: 38866.2 Da    PI: 4.9044
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00045.1_g00065.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rgrWT+eEde l ++++  G g+W++ +++ g+ R++k+c++rw +yl
  Rsa1.0_00045.1_g00065.1 14 RGRWTAEEDETLTNYIQINGEGSWRSLPKKAGLLRCGKSCRLRWINYL 61
                             8*******************************99************97 PP

2Myb_DNA-binding57.43.4e-1867112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+ T+eEde +v+++ +lG++ W++Ia +++ gRt++++k++w+++l
  Rsa1.0_00045.1_g00065.1  67 RGNITAEEDETIVKLHSLLGNR-WSLIATHLP-GRTDNEIKNYWNSHL 112
                              7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.326961IPR017930Myb domain
SuperFamilySSF466891.39E-2811108IPR009057Homeodomain-like
SMARTSM007176.5E-121363IPR001005SANT/Myb domain
PfamPF002493.6E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-211568IPR009057Homeodomain-like
CDDcd001678.61E-81661No hitNo description
PROSITE profilePS5129427.65862116IPR017930Myb domain
SMARTSM007174.2E-1766114IPR001005SANT/Myb domain
PfamPF002496.8E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2569116IPR009057Homeodomain-like
CDDcd001671.02E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRTPCCEKI GLKRGRWTAE EDETLTNYIQ INGEGSWRSL PKKAGLLRCG KSCRLRWINY  60
LRMDLKRGNI TAEEDETIVK LHSLLGNRWS LIATHLPGRT DNEIKNYWNS HLSRKIYAFT  120
AARRDEHGLN VTDLVMNKSF SSSSFSSSRA KKKKGRTSRA SMKKHKQRLT ASQCTPQLKE  180
LESDISEEGH NGNFEGKSLE PYEWLDGEIE RLMGSSVWEC TNEETVVEVN HDDSVENKVC  240
ESGDNSSCCV GLFEEEHGKL GNLEVDHDMN VEKEREGSGL SSNSNENGDK DWWVDLCDSL  300
EIGFGIDYEL LGWEFQGDVP CQSDDLWDLS DFREIPQVDR I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111873.10.0PREDICTED: myb-related protein 308-like
TrEMBLM4F4Z10.0M4F4Z1_BRARP; Uncharacterized protein
STRINGBra036145.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-155myb domain protein 111